- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
-
Your selected country is
United States
- Change country/language
-
Promotions
-
sk-testpage
-
BD Primer Program
-
BD Discovery 2021
-
Reagents
-
DO NOT PUBLISH
-
Reagentes Com Valor Promocional
-
Lunch Box Giveaway
-
EQCプログラム 外部精度管理 施設間精度管理
-
Backbone Reagents Promo
-
Backbone Reagents Promo
-
Classic Dyes
-
Back to Lab
-
End of Year
-
Tcell Backbone Panel Promotion
-
BD Horizon™ Human T Cell Backbone Panel
-
New Lab Promotion
-
Flash Sale
-
BD Panel Design Program
-
Real Dyes Sample Offer
-
BD’s 50 Years of Innovation Research Instrument Promotion
-
BD FACSLyric™ Flow Cytometers 50th Anniversary Promo
-
BD FACSAria™ Customer Loyalty Promotion
-
FlowJo™ Software Promotion
-
BD® Research Cloud Promotion
-
sk-testpage
-
Custom BD® AbSeq
-
Custom AbSeq FAQ Answer 2
-
Custom AbSeq FAQ Answer 3
-
Custom AbSeq FAQ Answer 4
-
Custom AbSeq FAQ Answer 5
-
Custom AbSeq FAQ Answer 6
-
Custom AbSeq FAQ Answer 7
-
Custom AbSeq FAQ Answer 8
-
Custom AbSeq FAQ Answer 9
-
Custom AbSeq FAQ Answer 10
-
Custom AbSeq FAQ Answer 11
-
Custom AbSeq FAQ Answer 12
-
Custom AbSeq FAQ Answer 13
-
Custom AbSeq FAQ Answer 14
-
Custom AbSeq FAQ Answer 15
-
Custom AbSeq FAQ Answer 16
-
Custom AbSeq FAQ Answer 17
-
Custom AbSeq FAQ Answer 18
-
Custom AbSeq FAQ Answer 19
-
Custom AbSeq FAQ Answer 20
-
Custom AbSeq FAQ Answer 2
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- United States (English)
- Change country/language
Old Browser
Your account has been put on hold due to inactivity. To re-activate, check your account information and make all necessary updates.
Looks like you're visiting us from {{countryName}}.
Would you like to remain on the current country site or be redirected to one based on your location?
live copy GB
Your account has been put on hold due to inactivity. To re-activate, check your account information and make all necessary updates.
Overview
Understanding the intricacies of the immune system is crucial to elucidating roles of immune cells in health and disease. This requires profiling T- and B-cell receptors (TCRs and BCRs), key determinants of adaptive immunity. The next generation of BD Rhapsody™ TCR/BCR Multiomic Assays reveal immune repertoire richness with great sensitivity alongside simultaneous single-cell gene and protein expression analyses.
Features
Validated on our new Enhanced Cell Capture Beads V3, BD Rhapsody™ TCR/BCR Next Multiomic Assays enable a highly sensitive analysis of full-length TCR/BCR repertoires with robust workflows for human and mouse. Key features include:
- Superior full-length TCR and BCR pairing metrics
- Multiomics-enabled for simultaneous immune profiling alongside protein and gene expression analyses in the same cell
- Compatibility with preserved cells and BD® OMICS-Guard Sample Preservation Buffer
- Intuitive data analysis pipeline that provides unbiased insights about the biology of your samples
Learn more from the BD Rhapsody™ TCR/BCR Next Multiomic Assay Brochure.
Applications
A single workflow to identify and analyze T and B cell clonotypes with high sensitivity alongside single-cell whole transcriptome or targeted mRNA expression and protein analyses.
In this study, we simultaneously analyzed TCR, BCR, whole transcriptome gene expression as well as cell surface proteins using the BD® AbSeq Immune Discovery Panel in primary PBMCs. In total, 2,380 complete phenotypes were detected from 6,798 putative cells (out of 7,292 input cells).
Step 1:
Using both protein and gene expression, a UMAP plot was generated, and protein markers were used to identify cell populations.
Step 2:
An unsupervised analysis (phenograph) was performed on CD8+ cells where 11 clusters were identified.
Step 3:
Frequencies of unique clonotypes within CD8+ were reported.
Step 4:
The top 5 clonotypes were overlaid on the UMAP plot and identified within phenograph clusters.
Step 5:
Using WTA and AbSeq information, differential gene and protein expression analysis of cells with the most frequent clonotype vs the rest of the population were performed.
Step 6:
Cell IDs and chain information were obtained from the pipeline output files and VDJ and C gene information were determined for the clonotype of interest.
Cell Index | TCR Alpha Gamma V gene dominant | TCR Alpha Gamma J gene dominant | TCR Alpha Gamma CDR3 translation dominant | TCR Beta Delta V gene dominant | TCR Beta Delta D gene dominant | TCR Beta Delta J gene dominant | TCR Beta Delta C gene dominant | TCR Beta Delta CDR3 translation dominant | TCR Paired Chains | Cell type experimental | High quality cell |
---|---|---|---|---|---|---|---|---|---|---|---|
236563 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
638393 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
1789392 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
2461787 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
Step 7:
Full-length sequence of the clonotype was obtained (nucleotide sequence also available) from the pipeline output.
Cell Index | VDJ Translation Trimmed |
---|---|
236563 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
236563 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
638393 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
638393 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
1789392 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
1789392 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
2461787 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
2461787 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
TCR_alpha | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGK KKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
TCR_beta | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
- Brochure
- Protocols (Human)
- BD Rhapsody™ System TCR/BCR Next and Targeted mRNA Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next, Targeted mRNA, and Sample Tag Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next, Targeted mRNA, and BD® AbSeq Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next, Targeted mRNA, BD® AbSeq, and Sample Tag Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next and mRNA Whole Transcriptome Analysis (WTA) Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next, mRNA Whole Transcriptome Analysis (WTA), and Sample Tag Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next, mRNA Whole Transcriptome Analysis (WTA), and BD® AbSeq Library Preparation Protocol
- BD Rhapsody™ System TCR/BCR Next, mRNA Whole Transcriptome Analysis (WTA), BD® AbSeq, and Sample Tag Protocol
- Protocols (Mouse)
- BD Rhapsody™ System Mouse TCR/BCR Next and Targeted mRNA Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next, Targeted mRNA, and Sample Tag Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next, Targeted mRNA, and BD® AbSeq Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next, Targeted mRNA, BD® AbSeq, and Sample Tag Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next and mRNA Whole Transcriptome Analysis (WTA) Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next, mRNA Whole Transcriptome Analysis (WTA), and BD® AbSeq Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next, mRNA Whole Transcriptome Analysis (WTA), and Sample Tag Library Preparation Protocol
- BD Rhapsody™ System Mouse TCR/BCR Next, mRNA Whole Transcriptome Analysis (WTA), BD® AbSeq, and Sample Tag Protocol
For Research Use Only. Not for use in diagnostic or therapeutic procedures.
Report a Site Issue
This form is intended to help us improve our website experience. For other support, please visit our Contact Us page.